PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_07385A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 394aa    MW: 43920.6 Da    PI: 10.3955
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_07385AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.33.6e-0863100342
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcks 42 
                                rW+++E   +++a + +G++ Wk+I+ ++  +++  +++s
  Oropetium_20150105_07385A  63 RWSKDELRHFYEAYRVHGKD-WKKISLMVA-NKSSDMVRS 100
                                9*****************99.********9.999999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.32659116IPR017884SANT domain
SuperFamilySSF466891.12E-963108IPR009057Homeodomain-like
CDDcd001674.04E-563100No hitNo description
PfamPF002497.0E-763100IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MAIAARRYQA GEIFSVLMGP AKGTRVINKA VIKGYVDQQQ PEDPQSSSKS KQKKRKIAEL  60
DPRWSKDELR HFYEAYRVHG KDWKKISLMV ANKSSDMVRS LYSIHRTFLS LPEHQATATG  120
FIALVTGDRN ALDESTNHRG GDQAVRASGK PRKRPRVQKA KEGLDQHHSC HDRTISGFSS  180
SFKKRYYGGK KSQIQTVGRR TPRTPVTVTA DRNATDDDMP KFENVNNSNK NIAEDINNVC  240
NNSPMDEFSP NGSSGITEAN KTDQDRALLD SKGAGESEIY PSQYLKKRKI QQITDEEVQT  300
GQVEHETMRA TKKGIKLADS LKQQVLSDFI SEDDMLVLDV LQSLVNAPSK TSKFKLNIPS  360
GKQANQIGKG SAPKTRQKKQ KKVLNAELFS LSV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1149155KPRKRPR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968511.11e-133PREDICTED: protein ALWAYS EARLY 2-like
TrEMBLK3XEE31e-133K3XEE3_SETIT; Uncharacterized protein
STRINGSi000260m1e-132(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86963038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21430.28e-20DNA binding